PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.E00567.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family BBR-BPC
Protein Properties Length: 310aa    MW: 34471.8 Da    PI: 10.1238
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.E00567.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind331.91.7e-101233091301
         GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki.....rernlalsekkaavaerd..........maflqrdkalaernkalverd 78 
                       md+d+   rn+gyyep a +k ++gl+lm+s+aerd+k+     r++ + + ++++a+++rd          m++  r+ ++++        +
  Migut.E00567.1.p  23 MDEDNL--RNWGYYEPPAPMKGQIGLNLMQSMAERDTKPsfltgRDHPV-MVSTNGAFHPRDcvvteppltrMEY-VREDWINH--------R 103
                       788855..9*********************************9777777.999**********************.77889999........4 PP

         GAGA_bind  79 nkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkks 171
                        kl+++  +++       ++   +sg++++  +q++++p+ +++a +      +e +p+++++ ++k++++      +++pk++k kk++k +
  Migut.E00567.1.p 104 GKLMQIFSNNH-----YNPNLAESSGSHHVP-MQMIQQPEPTEEARP-----VMEDPPVKKEPGTTKKRASAA----SSTPKAPKGKKPRKGP 181
                       55555554333.....223344455666665.555333333333333.....456677777666666555544....7889999999999977 PP

         GAGA_bind 172 ekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqga 264
                       +k++++ +++   +r+k  kk+i++v++gv++D++++P+PvCsCtG+++qCY+WG+GGWqSaCCtttiS+yPLP+stkrrgaRiagrKmSqga
  Migut.E00567.1.p 182 AKENSSGNPSV--QRAKPAKKNIEVVIDGVDMDITGIPIPVCSCTGQPQQCYRWGCGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGA 272
                       66666665555..79****************************************************************************** PP

         GAGA_bind 265 fkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                       fkk+LekLa+eGy ++np+DLk++WAkHGtnkfv ir
  Migut.E00567.1.p 273 FKKVLEKLAGEGYIFANPIDLKSFWAKHGTNKFVVIR 309
                       ***********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.8E-14923309IPR010409GAGA-binding transcriptional activator
PfamPF062172.4E-10425309IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MLIFVVFTLS SFVKQSKFVF TIMDEDNLRN WGYYEPPAPM KGQIGLNLMQ SMAERDTKPS  60
FLTGRDHPVM VSTNGAFHPR DCVVTEPPLT RMEYVREDWI NHRGKLMQIF SNNHYNPNLA  120
ESSGSHHVPM QMIQQPEPTE EARPVMEDPP VKKEPGTTKK RASAASSTPK APKGKKPRKG  180
PAKENSSGNP SVQRAKPAKK NIEVVIDGVD MDITGIPIPV CSCTGQPQQC YRWGCGGWQS  240
ACCTTTISMY PLPMSTKRRG ARIAGRKMSQ GAFKKVLEKL AGEGYIFANP IDLKSFWAKH  300
GTNKFVVIR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012846150.10.0PREDICTED: protein BASIC PENTACYSTEINE2 isoform X1
SwissprotQ9SKD02e-97BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A022QNC40.0A0A022QNC4_ERYGU; Uncharacterized protein
STRINGVIT_01s0011g06380.t011e-130(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA90612429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.26e-90basic pentacysteine1